PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G039000.1.p
Common NameCOL13, GLYMA_19G039000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 367aa    MW: 40905.6 Da    PI: 5.5623
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G039000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.77.4e-062060438
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         r+C+++ + +  l+C+ ++ +lC +C    H        H+
  Glyma.19G039000.1.p 20 RVCDTCLSAPCVLYCHADSAYLCSSCDARVHAAnrvasrHK 60
                         68**************************9995556677776 PP

2zf-B_box29.91.1e-0961107242
             zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          + ++C+ +e+ ++ + C+ +   lC +C   +H+       H++vp+
  Glyma.19G039000.1.p  61 RVWVCEACERAPAAFLCKADAASLCSSCDADIHSAnplasrHNRVPI 107
                          5689*****************************66999999*99997 PP

3CCT70.25.3e-24297340144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eK+ktRkFeKkirY+sRKa+Ae+RpR+KGrF+k++
  Glyma.19G039000.1.p 297 REARVLRYREKKKTRKFEKKIRYASRKAYAETRPRIKGRFAKRT 340
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.2E-81764IPR000315B-box-type zinc finger
PROSITE profilePS501199.6551764IPR000315B-box-type zinc finger
CDDcd000212.70E-72064No hitNo description
PROSITE profilePS5011911.19260107IPR000315B-box-type zinc finger
PfamPF006431.0E-761107IPR000315B-box-type zinc finger
CDDcd000212.92E-763107No hitNo description
SMARTSM003362.0E-965107IPR000315B-box-type zinc finger
PfamPF062038.2E-18297339IPR010402CCT domain
PROSITE profilePS5101716.827297339IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MLKEGTNNVG GSNTGTTWSR VCDTCLSAPC VLYCHADSAY LCSSCDARVH AANRVASRHK  60
RVWVCEACER APAAFLCKAD AASLCSSCDA DIHSANPLAS RHNRVPILPI SGSLFREPEH  120
NHKRVEHAFV NEVEEEEEGV FDEYEDEVEA ASWLLPHPMK NNDEIEENDC GDEGFLFVDE  180
YLDNLVDCCN SCGHNDNQFS NVYQHQQNYN TVPQNYVVVP VQVPQHFQPG LDFDSSKAGF  240
SYDGSLSQSV SVSSMDVGVV PESTVSGISM SHSKSPIGTN DLFPPLLMPS HLTPMDREAR  300
VLRYREKKKT RKFEKKIRYA SRKAYAETRP RIKGRFAKRT DVEAEVDQMF STKLFNEVGG  360
SIFPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.253744e-64leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0689010.0HM068901.1 Glycine max CONSTANS-like zinc finger protein (COL13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001278944.10.0zinc finger protein CONSTANS-LIKE 2-like
SwissprotQ965021e-115COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A0B2REJ30.0A0A0B2REJ3_GLYSO; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI1N6I80.0I1N6I8_SOYBN; CONSTANS-like zinc finger protein
STRINGGLYMA19G05170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-68CONSTANS-like 2